TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A4SF64|A4SF64_CHLPM Permease YjgP/YjgQ family protein OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=Cvib_1109 PE=4 SV=1
MKLIDRYILKAHVGPFFFAFLTIIFVLILQFFASFADRFIGRGIGFGALVELIALQSAWMVGLAAPMAVLIAVVMAFGAL
TTTSEMTVFRASGVSLYRLMIPILLAGLVLSFFVERFNNVVQPLANYQARSLMDDIVKAKPNFGITENAFSPLVDGYSIL
VRKSDERTGGIGDIIIYDSTRPDFRSVITAEEGRISFSDDGGYLLLTLRNGEIHEVQQPDYRLYRKMSFQQHRYVFESTG
FGFSRSDDRRNRAGGKELSAKELLLVAGEYQRKVDDSEKHIGMSLEMFEQALSVVTPAGAVSYPQLKSPNAAAASAVAGY
LDRQLAVLQSELTNRDVNQGMVNRFMAEYHKKYALAFACFFFVLVGAPLGILARRGGFGIGAILSLFFFVLYWILMIAGE
KMAVRGVLEPWAAIWMADAVMAAIGLTLVISLTGAVFNSNR