TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A6CDW2|A6CDW2_9PLAN Uncharacterized protein OS=Gimesia maris DSM 8797 GN=PM8797T_01869 PE=4 SV=1
MRLLQRYVLFELLRVFTLMITVLTVLLVFVGAFQQATSQGLGVILVLKILPFIVPSMLPFTIPATLLLTVCVVYGRIAGD
QEITAAKAAGINVLSLLWPSFILGGFLSLGSLILSDQIIPWAEKNIENTIACELETIFLEKLRSQNQIHDPTSGISITVM
GVRNKTLLVPTFRYSPPNKKPVHLQAEEATLEFDLTNQQVILHISKGHIDFPGKPRFFVEKDTFPFPLPSQTTMAKPRHM
SVKSIKSELVDLSEKKNEFEFQRDIEVAMLLALGDFEHFQSPEVNTDLPQNQFQEKRQNKLKTALSSRFALSCSCFFFVL
VGCPFSIAQARRQFLTSFFLVFLPILLFYYPIVLLAINLAKQGKIEPTWSLWAGNAGLLIVAIHMLRKVLRN