TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8HQH0|A8HQH0_CHLRE Predicted protein OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_171760 PE=4 SV=1
MPSQARWSSLHEPQRTVPFKLIYTGHRAGFDLLAEASFQALIGLVLLTGVGNRVLYKMALLQNLGYLAVYFTALAWRRST
GQVTTAMMNIDKRPLLAVGACEAAAQLLFMVGAAHIPGALLPVVNQTYLVWSLVFASLILGTRYSWMQLAGAGLVMLGVV
CAAVQPGVVAGMLGMGSGAAAAAAAHAAVDLRYVAVCVACFAFPAIANCIKEKVFSSAAQKLGQPLDIFVVNSFGSLAQT
FFVLLLLPITTALKGIALSDLPAHLMASSRAFLGEPSAAACAAFGGGADAGGLVGVLARHSTPLLALSYVALNLVFNVAM
LNLLRSVGSVTTTLVGSSLVPLTIAAFTLPLPYLEPAVIGPNFLLPVQAAKQGEKGSDGDRKNR