TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A8J3N0|A8J3N0_CHLRE Predicted protein OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_149177 PE=4 SV=1
MLSPIAARAVGGSGRFSTSGGEDIWSTYRPTHDEEQPETASEEAEKKGRGAYLLTCLIGYSMSFIVFGSQVSILGPTIAG
LADRLGVEEPDLSPLFTALGVSCIVSGTPSGWLVDRVPTHHVLIGSLVIEAIGFSLVPLMPSVWSLTALYFVVCFSYNFT
NSAVFTSLAWMFPKRAGPGINLVLAMFGLGSFFIPLAAQACKIYLGSALAVFYLVGGLAALSAVPFFFVTSPARPVAAGG
DGAHGARHHASRTLELVTTVAVVVLVFFTTAAETAIGNWIYTFSLREVGDSDAAAAAANSAFWGAFTVGRVFGAAISHAT
TPAVLLLGSVPFSILGCALPLLAGRAQLSRSLVLAMAALTGLGNSAGYANAVALLECYVPVTGFINGVFGAVAGGACMVG
PVLVAMMAKYTSLRYMSMPWVGLVLYALHLPAILTAITAGTKLLKLPLAPEEEPFLAPAGAAVTAATENGAGHSIAPAAA
APPQADGAVTNGHH