TCDB is operated by the Saier Lab Bioinformatics Group
>AHW68364.1 hypothetical protein NP_c37 [Nosema pernyi]
MTFVRRFYLNAYRTERFFLGLAFQMLVLLLLVGCLYLAVRIIVGKSLSDVMPGTRSFKILVDYGKSYFTSDMKRFLSHFL
FTIFFIVATLYVFYLKNVCDNRIQILEDIYSAKYSVLTCFLGYMLHDFFVTTFWFTFTYGVVLFSGLLSLINYWYPIYIF
LAICCFTINYIFMKYLFGFSNKSKILSSIMLGTGIFAGDPKFFNNMINFISRSAPGHENKIKYVGSIFIIFPQMLLVGLI
NYKNIQSIQDHKGDLKNNQLYVPDVCYENLKNEEPSFQFRFLGLDDAPYGVVVSIFIVSLLVNFFGALYLFNRHVNAELR
LKMK