TCDB is operated by the Saier Lab Bioinformatics Group
>AXA98483.1 Ryanodine receptor [Sesamia inferens]
MAESEGGASEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFPENIADKNIPPDLSQCVFVIEQALSVRALQELV
TAAGSETGKGTGSGHRTLLYGNAILLRHLNSDMYLACLSTSSSQDKLAFDVGLQEHSQGEACWWTLHPASKQRSEGEKVR
VGDDLILVSVATERYLHTTKENEVSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWTKDG
GQNIVVYEGGSVMSRARSLWRLELARTKWAGGSINWYHPMRIRHITTGRYLGVNDQNELYLVSREEATTASCAFCLRQEK
DDQKQVLEDKDLEVIGAPIIKYGDSTVIVQHSETGLWLSYKSYETKKKGVGKVEEKQAILHEEGKMDDGLDFSRSQEEES
RTARVIRKCSSLFTKFINGLETLQENRRHSMFFASVNLGEMVMCLEDLINYFAQPDDDMEHEEKQNRFRALRNRQDLFQE
EGILNLILEAIDKINVITSQGFLAGFLAGDESGQSWEMISGYLYQLLAAIIKGNHTNCAQFANSNRLNWLFSRLGSQASG
EGTGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRDPKVLDVLCSLCVGNGVAVRSSQNNICDYLLPGKNLLLQT
ALVDHVSSVRPNIFVGRVEGSAVYRKWYFEVTMDHIEKTTHMMPHLRIGWANTTGYVPYPGGGEKWGGNGVGDDLYSYGF
DGAYLWSGGRKTMVNRTHQEEPYIRKGDVIGCALDLTVPIINFMFNGMRVTGSFTNFNLEGMFFPVISCSSKLSCRFLLG
GEHGRLRYAAPEGYSPLVESLLPQQILSLEPCFYFGNLSKRALAGPPLVQDDTAFVPTPVDTIQITLPSYVEQIRDKLAE
NIHEMWAINKIEAGWMYGDQREDLHKIHPCLVPFERLPPAEKRYDIQLAVQTLKTILALGYYISLDKPPARIRNVRLPNE
PFMQSNGYEPAPLDLSAVTLTPKMDELVDQLAENTHNLWARERIQQGWTYGLNEDPDMHRSPHLVPYPKVDDAIKKANRD
TASETVRTLLVYGYMLDPPTGEQHEALLLEASKQKQADFRTYRAEKNYAVGSGKWYFEFEILTAGPMRVGWAHADMAPGM
MLGQDENSWAFDGYNEEKVYSGSTESFGKQWAVGDVVGVFLDLIDKTISFSLNGELLMDALGGETTFADVQGDNFVPACT
LGVGQKARLTYGQDVNTLKYFTTCGLQEGYEPFCVNMKRDVTHWYTKDQPIFENTDEMTDTGIDVTRIPAGSDTPPCLKI
SHNTFETMEKANWEFLRLSLPVICHLEFIDESEKARRWIEIKERQQILMKEAVEAQMPAHIDQIMRSGFTMNDIKGMHYE
DNQEEMPTSSKAKRLPSRPPRKGSVTRGVSIQNYNNLQTGPQVNGMHRSTSEAEMAKYELGAQNLAPDDKKDKRGRSPFK
FFRSKRGESNDRGKSRKSKTPDPFSDTEVSPERGPRRPNPQIKVSQANQKYNGMNARPSRANLYGSQAGLNMATPTQDRK
QMTTSTLAQSATETVGNEIFDAECLKLINEYFYGVRIYPGQDPTHVYIGWVTTQYHLHSKDFNQSKVTKSSVIITDDYDR
IIENVNRQSCYMVRADELYNEVMAEATAKGASQGMFIGCSVDTSTGTVSFTCEGKDTSIKFKMEPETKLFPAIFVEATSK
EILQIELGRSTTSLPLSAAVLPTSDKHVIPQFPPRLKVQCLSPHQWARVPNQSLQVHALKLSDIRGWSMLCEDAVSMLAL
HIPEEDRCIDILELIETDKLLSFHSHTLTLYAALCYQSNYRAAHALCTHVDQKQLLYAIQSQYMSGPLRQGFYDLPIALH
LESHATTMEACKNEFVIPLGPELKSLYEDPDMGHSLRSLQTESVCPQMKMTDIAESITEISNLYSPYFPLEVVREFVMQA
LAEAVETNQVHNRDPVGGSNENLFLPLIKLVDRLLLVGMMRDEDVEKLLIMINPETWDPSFDREGKDEHRKGLLHMKMAE
GAKLQMCYLLQHLNDIQLRHRVEAIIAFAHDFVGDLQTDQLRRYTEIKQSDLPSAVAAKKTREYRCPPREQMNAILSFKH
LEESEEKDNCPCGEELIARMNDFHESLMAHVSLHALQEPDGSENQEPEAKPGAFGQLYNIINTVKDMEEEAKAIEEPIRK
TPEEKFRKVLIQTIVSWAEESQIETPKLVREMFSLLVRQYDAVGELIRALEKTYVINAKTKLDVAEMWVGLSQIRALLPV
QMSQEEEELMRKRLWKLVNNHTFFQHPDLIRVLRVHENVMAVMMNTLGRRAQAQSDAQPASPPVTEDKQEKDTSHEMVVA
CCRFLCYFCRTGRQNQKAMFDHFDFLLENSNILLSRPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQ
SNSELIEKGYPDLGWDPVEGERYLDFLRFCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLLKAIVDANKMSER
IADRRKLREIEQEGDVTFTHPLPESDEDEDYIDTGAAILNFYCTLVDLLGRCAPDAGVIALGKNESLRARAILRSLVPLE
DLQGVLSLRFTLNNPAAGEERPKSDMPSDLIPGHKQSVGLFLERVYGIETQELFYKLLEEAFLPDLRAATMLDRNDGCES
DMALSMNRYIGNSILPLLIKHAYFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSAMQPSMLLKLLR
KLTVDVSKLSEYTTVALRLLTLHYERCAKYYGSTGAGQGVFGASSDEEKCLTMMLFSNIFDSLSKMDYEPELLGKALPCL
IAIGCALPPDYSLSKNYDDEFYGKEQVTGGLDNPQYDPQPINTSSVALNNDLNTIVQKFSEHYHDAWASRKIENGWVYAE
SWSDSQKSHPRLKPYNMLNDYEKERYKEPVRESLKALLAIGWSVEHSEVDIPSTNRSSMRRQSKSGGRPPDIVTDSATPF
NYNPHPVDMTNLTLSREMQNMAERLADNAHDIWAKKKKEELVTNGGGIHPQLVPYDLLTDKEKKKDRERSQEFLKYLQYQ
GYKLHRPSKAPQSDTEQTTTGVAIELRFAYSLLEKLIQYIDRATINMKLLKPSTTFSRRSSFKTSTRDIKFFSKVVLPLM
EKYFSTHRNYFIAVATATNNIGAASLKEKEMVAALFCKLASLLRSRLAAFRPDVRITVRCLQVLVKGIDAKSLVKNCPEF
IRTSMLTFFNNVADDVGHTINNLQEGKYAHLRGTHLKTSTSLGYINGVLLPILTAKFDHLANCEYGSDLLLDEIQVASYK
MLGSLYALGTDATLTHDRKYLKTEIERHKPALGSCLGAFSSTFPVAFLEPHLNKHNQFSLLNRIADHSLEAQDIMQKMEQ
CMPTLETILGEVDQFVESDKTYNEAPHIIDVVLPLLCSYLPFWWAQGPDNVTPTGGNHVTMVTAEHMNQLLKNVLKLIKK
NIGNENAPWMTRIATYTQQIIINSSEELLRDSFLPLAERVRKRTDNMFHKEESLRGFIKSSTDDTSQVESQIQEDWQLLV
RDIYSFYPLLIKYVDLQRNHWLRNNVPEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMVLIMPTATRRLTAVT
DGTPQAGGKKKKKHRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRFLKVGTLKKMSEQDVAEFAKT
QLTLPDKIDPADEMSWQHYLYSKLGSKSKSNITVETAENKAKIIDDTVERIVAMSKVLFGLHMIDHPQQMSKNVYRSVVS
IQRKRAVIACFRQTSLHSLPRHRACNIFARTYYELWLEEENKGQEVMIEDLTQSFEDAELKKSDVVEEGEKPDPLTQLVT
TFCRGAMTERSGALQEDPLYMSYAHIIAKSCGEEEEEGGGEEEEGGGGEPEAEEEGRASIHEQEMEKQKLLFHQARLADR
GVAEMVLLHISASKGLPSEMVMKTLQLGISILRGGNIDIQMGMLNHLKDKKDVGFFTSIAGLMNSCSVLDLDAFERDTKA
EGLGVGLEGAAGEKNMHDAEFTCALFRFIQLTCEGHNLDWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSS
KELIDPAGKANFFKAIGVASQVFNTLTEVIQGPCTQNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNL
QKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLKDLTSSASFQEIDANSDGWVLPKDFKEKMEQ
QKSYAPEEIEFLLACCETNHDGKLDYVGFCDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLG
RIEIMGGSKRIERVYFEIKESDIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMAASEESV
GGTKNREASYMYMGDDDDERAGKDPFRRGLQSVKDGFATAFSSLSPSNIKQKIADMQQMPPAELAVGFFKMFFYLFYYLG
YGVLVVVRYILGVLLGLMRGPQTDEPPPEPTEEEKIGQLRHRLLATQSSRHLPALPAADDTGQLQVSAFGLDITKEDNGQ
IQVKPHESPSTSTPSSGEEAEVSPDEGTEHSEEQRPPSLIDLLGGEQAKKQAQERMEAQAAQQAAMSAIEAESKKAVQVP
APSALSQVDLSQYTRRAVSFLARNFYNLKYVALVLAFCINFVLLFYKVSTLDVEGGEGSGIGDIIAAAAGSGSGSGSGSG
DGGSGESDDADDVIEVVHIDEDFFYMEHVIKVAAAMHSVVSLAILIGYYHLKVPLAIFKREKEIARKLEFDGLYIAEQPE
DDDLKSHWDKLVISAKSFPVNYWDKFVKKKVRAKYSETYDFDSISNMLGMEKTSFTAQEDEGSKGLINYIINIDWRYQVW
KAGVTITDNSFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTIIVYIYTVIAFNF
FRKFYVQEEDDEVNRNCHDMLTCFVFNLYKGVRAGGGIGDELEPPDGDDSEVYRIIFDITFFFFIIVILLAILQGLIIDA
FGRLRDQLESVKEDMESNCFICGINKDYFDKVPHGFDTHVQREHNLANYMFFLMHLINKPDTEYTGQETYVWNMYTQRCW
DFFPVGDCFRKQYEDLMGE