TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C1F9I2|C1F9I2_ACIC5 TonB domain protein OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=ACP_2139 PE=4 SV=1
MESGGKIKTKSKYYVWVGVFLNCSILAAVVLYPLIYPEALPKAMMTTLLVAPPPPPPPPPPPPPTPPQPKVQMQVNPMAV
PTKIPKVIKMVKQQPPPSTGVMGAGVAGAGDGVPGGIFSGLGSGPAPVVKAAPQKPLRVSAGVVSGNKIGGVNPSYPPIA
KAARIQGTVVLSALISKAGTIEDLKVVSGPAMLQNAALEAVRTWRYKPYILNGEPVQVETQINVVFNLGD