TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C8X4B7|C8X4B7_DESRD Uncharacterized protein OS=Desulfohalobium retbaense (strain DSM 5692) GN=Dret_2107 PE=4 SV=1
MRFPLSFRDLTYSVPWNLWLLTSGSILIAFGLKSIAIPQGFVSGGAGGVAMLLYYIFGGLEPGAWYLVINIPIFILGWLW
VSKRFFLYTLYGTIIVGVFMDVITYTAPISDPILAMLASGAVIGAGTGITLRSLGSTGGTDIIAIILNQKLNVRIGNTYF
TFNVFLFAASLAFLNLDIVLYSLAMVFILGLVTDHFLSLFNQRKLVLIVSDLTDAIANEISEKINKGSTFLYGRGSYTGR
RKKVLLTVINNYQVKRLEEIVYGVDPYAFTIVENTWHVLGSDFAKRKVY