TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C9RT46|C9RT46_GEOSY Extracellular solute-binding protein family 1 OS=Geobacillus sp. (strain Y412MC61) GN=GYMC61_2709 PE=4 SV=1
MLKKAFTALTAAALAVGMLAGCTDSQSSSSSGSGDSKEKNGVVTITTVRTLKDDTKFREGEDLNNNPITRWSEKELGIKW
KTLWTAPNDEQYHNKIRLALSSGQKLPDVFKVSDGQLINDLIRSGKVMPVDEAIEKYASPRLKKIYEQFPEAFYPATVDG
KRYGIPRFSGGNGSDSLLWIRKDWLDKLGLQPPKTIEDLEKIMDAFVNKDPDGNGKKDTIGLTLASKNGLATWLADGSFI
FGAYGNYEPGSWSKGEDGKLVYGSVQPSMKKALAKLNEWYQKGYLDKEVGILDEQTAIKSFVAGKSGIISAPPWAAGWPI
ADALKNNPGAVVEPYPLPSGPDGKIGRRGEGLVTGMFLFSKDFKHMDKFFQYLDEAYAYVYNDSKYFKYGLAEGYDYVMK
NGKPVYDDQEIPGGRLDPGAYFITEAIPTVPYMLYDLVEELYTTKRQPKNAYEYTRIVSLGESFMKAATIVNQQNQYRIE
NEFTGPPTKTMQKRGEFLTKMERETFANIIYGRTPLSAFDDFVKKWEESGGEEITKEVNEWYQSVKGAK