TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D1YY51|D1YY51_METPS Putative uncharacterized protein OS=Methanocella paludicola (strain DSM 17711 / JCM 13418 / NBRC 101707 / SANAE) GN=MCP_1301 PE=4 SV=1
MSAARAFYYTIKADFLERVRSYSFLVVLLLTMLAAYVFVPGPDAGYMTLKLSSTDGFYRGIYNSAWVGAMVSLPTTLFLA
LFGYFVVKNAVGRDRRTGVGQIIATTPISKPVYMLGKATSNFAVLAVIVGVMMAGALAMQLLPGETSAIDLWALWSPFIF
LSLPAMAVIASVAVLFESIWLLRGGFGNVVYFILYILVLVVLLTSASGIKWGDDLAFAKDMLGTSVGISSIEATAKIIYP
AFEPGHWSMGFAPIDHPPHTFMWNGIPWTPLILLGRLFWVLVACGIAVMASLFFDRFDSAGNVNAKTGKQTSRPEPLAIE
KPAVDARLTPLSSDKKSLNVLALFMAELKLAFKGQKWWWYAGAAIVILAGLVSSGSEERHFAMLAAMVWPVLIWSSMGTR
ERTFNMAQIVFSAPGPIKNQLPVMWLSGVCVGIVICSGVFVSMALSGSFGEMATLFTEMLLIPAMALAMGIWSGSSKLFE
ALYMILWYVGPVNGLPFLDLTGTIVSSMHIGLPAAYLAVTVVFMALMVMGRYRQTFA