TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D3R797|D3R797_BIFAB Raffinose transport system permease protein OS=Bifidobacterium animalis subsp. lactis (strain BB-12) OX=552531 GN=BIF_01594 PE=3 SV=1
MTTATANTMSQQSAQQSATMNTAPAKAEKFRKDRRINWWLTAVVAVFSLTILVPLYFTVVTALKTPAEAGTFSLPTSWQW
GNFAAASAKVDYPRAALNSAIITVLAVSLTLVTNTFVAYAIARNMDKRFFRFLYYFFIAAMFVPFPVVMLPLAKQMGSWH
LDNQAGLIVLYVILGLGTNLFIATGFIRSIPVSLEEAARIDGAGTWRIFWKIIFPLMGPINATIAIMTALWAWNDFLLPL
IILTDQSNQTIPLAQYVFSSQFATNYPQAFASYLMAMAPVLVVYIFAQKWVVGGVMRGAVK