TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D7BAR7|D7BAR7_MEISD Extracellular solute-binding protein family 1 OS=Meiothermus silvanus (strain ATCC 700542 / DSM 9946 / VI-R2) OX=526227 GN=Mesil_0672 PE=4 SV=1
MKGKKWWSVGLAGLGLAVLGALAQGGTLLFVSTQFTPIEEAQRMRQVILKDAPVKVEFVPEDNAPFTTRILSEARAGKVN
VSLVGGLHGDFPPLIQAGAMDNVDDVMAQLKDRKFSATFVNLGKMGTPNQLYIPWMQATYIMVANKQALQYLPAKASVNT
LTYSQLKEWGANLQKATGKRLLGFPAGPRGLMHRFTQGYLYPSYTKSAVSKFRSDEAENMWAEFKEIWQYVNPQSTTYDF
MQEPLLSGEVWVAWDHIARLRDALNQRPNDFVAFPAPIGPYGRGFMPVLAGLGIPKGAPNRAGAVATIEYLTRPEVQIAT
LVQNGFFPVIQIKLPDNLPQGIRMGAEAISKQSQSGVALPSLLPVGLGSKGGEYNKVFQDAFARIILRGEDIRRVLDSEA
TNLRRVINDTKAPCWSPDPASNGPCPVN