TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D7H9Q2|D7H9Q2_VIBCL TolA protein OS=Vibrio cholerae RC385 OX=345074 GN=VCRC385_02178 PE=4 SV=1
MKENKSRKSNDAKSITISLAMHGALVAILLWGADFTMSDPEPTGQMIEAVVIDPQLVRQQAQQIRSQREEAAKKEQERLD
KLRRESEQLEKNRQAEEERIRQLKEQQAKEAKAAREAEKLREQKEQERLAAEQKAREEKERAAKAEAERKVKEEAAKKAE
QERVAKEAAAAKAEQQRIEREKEAKLAEEKAKREKEVAAKAEQERLAKEKAAKEAADKAKKEKERAAKAEAERKAQEAAL
NDIFGSLSEESQQNNAARQQFVTSEVGRYGAIYTQLIRQNLLVEDSFRGKQCRVNLKLIPTGTGALLGSLTVLDGDSRLC
AATKRAVAQVNSFPLPKDQPDVVEKLKNINLTVAPE