TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D7P6B9|D7P6B9_9CHLO Mitochondrial ATP synthase subunit ASA2 (Fragment) OS=Polytomella sp. Pringsheim 198.80 PE=2 SV=1
DAAVALTYLQVKANRRLWGKVLEKAGAAQDYDAASLTNLLWAINTGGVEHFKTVAELAGPAVSLLPSLSPVQLSIVVEAL
GGAGVKNYELYNKASAVVVSKIGEFKPAEIARVLYGVAFGGVNDVALAKAAGKVFASTEVDSRTAAQALYALAKLGRADK
ATVDALLKSFKKGTESASDAAAASFALGSLSFKAEKAIVDALKASAGDLAPAQAVEAAYGLALSGATDAEAFKALFGVVA
PAIEKAPDALEVSSLAQLHVASTISGAKLPAAVGSFVAKAFGLAADAARLKRSSAESALVADVAAATAVAFGAQYRPEVA
SAVASYVKTAPDGSVLDIAITKGDAKVLVQAVPSSLLTSTTPAKPLGHVAAYSKVREAQGYAV