TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D7P897|D7P897_9CHLO Mitochondrial ATP synthase subunit ASA6 OS=Polytomella sp. Pringsheim 198.80 PE=2 SV=1
MMLRTLTRSSAVAGQAVRLFKTSAAAAEGNSVAGIIKSVNETSGANLLSSLKTIKAQAAPIYPAAASSTGYSTQAKIALF
GALSWILYRADGQSKAHEWIVDLNLNVLQAAWLISFSSLIPFRAVYFAFRGMAPATASTLNGLKTFSSISL