TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F9VRS8|F9VRS8_9ACTN Uncharacterized protein (Fragment) OS=Gordonia alkanivorans NBRC 16433 GN=GOALK_027_00010 PE=4 SV=1
MTSTEMGITANEEKVASGKKTPPAMVMLVGLTAGLGVILILLLMVFILPSLKSGAHDLRVGVVGAPAAVSSFERSLATAA
PDAYEPQRYDSEAGLRDAIEHREVVGGFVVDEAGVHTLVASAGSASISGSLTGTAQAVGQATGEKVTVEDVVPLPEGDPT
GIGIGGLAFPLVFGGIVPVVAFRKIFPRSNGWYLTGLITFSAVGGVIVASMLTFGFGSIDAGLWSTGFWAVAGSIALGVA
ALAIPLAGLQNAFGVKGFTIGANGHDVPRQSAGRYCRFGRVVAVRAGHRRTDPAAGCGRNPGPLGRLLRRCSRSHREADA
CHLDRRRSGAVRHGCATCRRVECRSRRDRQLGV