TCDB is operated by the Saier Lab Bioinformatics Group
>tr|G8EME3|G8EME3_PLUXY Ryanodine receptor 1 OS=Plutella xylostella OX=51655 PE=1 SV=1
MAEAEGGASEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIQDKNIPPDLSQCVFVIEQALSVRALQELV
TAAGSETGKGTGSGHRTLLYGNAILLRHLNSDMYLACLSTSSSQDKLAFDVGLQEHSQGEACWWTLHPASKQRSEGEKVR
VGDDLILVSVATERYLHTTKENEVSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSSWSNEG
QHNIVVYEGGSVMSQARSLWRLELARTKWAGGFINWYHPMRIRHITTGRYLAVNDQNELYLVSREEATTASCAFCLRQEK
DDQKVVLEDKDLEIIGAPIIKYGDSTVIVQHSESSLWLSYKSYETKKKGLGKVEEKQAILHEEGKMDGLDFSRSQEEESR
TARVIRKCSSLFTKFINGLETLQENRRHSMFFATVNLAEMVMCLEDLINYFAQPDEDMEHEEKQNKFRALRNRQDLFQEE
GILNLILEAIDKINVITSQGFLAGFLAGDECGQSWEMISAYLYQLLAAIIKGNHTNCAQFANSNRLNWLFSRLGSQASGE
GTGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRDPKVLDVLCSLCVGNGVAVRSSQNNICDYLLPGKNLLLQTQ
LVDHVSSVRPNIFVGRVEGSAVYQKWYFEVTMDHIEKTTHMMPHLRIGWANTTGYVPYPGGGEKWGGNGVGDDLYSYGYD
GAFLWSGGRKTGVNRTHAEEPYIRKGDVIGCALDLTVPIINFMFNGVRVTGSFTNFNLEGMFFPVISCSSKLSCRFLLGG
EHGRLRYAAPEGYSPLVECLLPQQILSLEPCFCFGNLAKRALSGPPLVQDDTAFVPMPVDTLTITLPSYIEQIRDKLAEN
IHEMWAMNKIEAGWMYGEHRENLHKIHPCLVPFERLPAAEKRYDIQLAVQTLKTILALGYYISLDKPPARIRNVRLPNEP
FLQSNGYKPAPLDLSAVTLTPKMDELVEQLAENTHNLWARERIQQGWTYGLNEDSDMHRSPHLVPYPKVDEAIKKANRDT
ASETVRTLLVYGYMLDPPTGEHEALLAEASKMKQADFRTYRAEKNYAVNSGKWYFEFEILTAGPMRVGWAHADMPPGMML
GQDENSWAFDGYNEEKVYVNSSESFGKQWAVGDVVGVFLDLIDNTISFSLNGELLMDALGGETTFADVQGDNFVPACTLG
VGRKARLTYGQDVNTLKYFTTCGLQEGYEPFCVNMKRDVTHWYTKDQPIFENTDEMADTRIDVTRIPAGSETPPCMKISH
NTFETMEKANWEFLRLSLPVICHAEFIDENEKARRWVEIKERQQALMKEAAEAQMPAHIDQIMRSGFTMNDIKGLHRDYD
DGQEEPSNSKMKRLPSRPPRKGSLSRGVTIQNYSLQPGQQNGMHRTASEMEMSKYESGAQSVTDDKKDKRGRSPFKFFSR
SKRGESGDRKSRKSKTPDPFSDAEVSPERAAPRRPNPQIRVSQANQRYEKNQSRQNLYGSQGGGLNNGNTNLQVNTPPVE
RKQMTGGALSGATTETVGNEIFDAECLKLINEYFYGVRIFPGQDPTHVYIGWVTTQYHLHSKDFNQSKVTKSSVIITDDY
DRVIRSVNRQSCYMVRADELYNEVMAEAVGKGASQGMFVGCSVDTSTGTVAFTCEGKETSFRFSMEPETKLFPAIFVEAT
SKEILQIELGRSLHSLPLSAAVLPTSDKHVIPQFPPRLKVQCLKPHQWARVPNQSLQVHALKLSDIRGWSMLCEDAVSML
ALHIPEEDRCIDILELIEMDKLLSFHSHTLTLYAALCYQSNYRAAHALCQHVDQKQLLYAIQSQYMSGPLRQGFYDLLIA
LHLESHATTMEVCKNEYVIPLGPELKALYEEPEMGHSLRSLQTESVRPMMKMTDIAESINEISNLYSPYFPLEVVREFVM
QALAEAVETNQVHNRDPVGGSNENLFLPLIKLVDRLLLVGMMRDEDVEKLLIMTNPETWDPTFDKEGKDEHKKGLLHMKM
AEGAKLQMCYLLHHLNDIQLRHRVEAIIAFAHDFVGDLQADQLRRYVEIKQSDLPSAVAAKKTREYRCPPREQMNAILSF
KHLEEDDKENIPCGEDLIARMNDFHQALMAHVSLMALQEPEVEENPEALNKPGAIGKLYNIINTVKELDEEPKAIEEPVK
KTPEEKFRKVLIQTIVSWAEESQIETPKLVREMFSLLVRQYDAVGELVRALEKTYVINAKTKLDVAEMWVGLSQIRALLP
VQMSQEEEELMRKRLWKLVNNHTFFQHPDLIRVLRVHENVMAVMMNTLGRRAQAQSDATPNQPAAEEKDTSHEMVVACCR
FPCYFCRTGRQNQKAMFDHFDFLLENSNILLSRPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNS
ELVEKGYPDLGWDPVEGERYLDFLRFCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGLLKAIVDANKMSEKIAD
RRKLHEEVGQEDVAFSHPLPESDEDEDYIDTGAAILNFYCTLVDLLGRCAPDASVIALGKNESLRARAILRSLVPLEDLQ
GVLSLRFTLNNPAMGEERPKSDMPSGLIPGHKQSIVLFLERVYGIETQELFYRLLEEAFLPDLRAATMLDRNDGCESDMA
LSMNRYIGNSILPLLIKHANFYNEAENYGSLLDATLHTVYRLSKNRMLTKGQREAVSDFLVALTSAMQPSHVAETAEETH
GDVSKLSEYTTVALRLLTLHYERCAKYYGSTGGQGVYGASSDEEKRLTMMLFSNIFDSLSKMDYEPELFGKALPCLIAIG
CALPPDYSLSKNYDDEFYGKEQQTTGGPDNPQYNPQPINTSSVALNNDLNTIVQKFSEHYHDAWASRKIENSWVYGENWS
DSQKAHPRLKPYNMLNDYEKERYKEPVRESLKALLAIGWSVEHSEVDIPSTNRSSMRRQSKSGGRPVDVVTDSATPFNYN
PHPVDMTNLTLSREMQNMAERLAENAHDIWAKKKKEELTVNGGGIHPQLVPYDLLTDKEKKKDRERSQEFLKYLQYQGYK
LHRPSKATQSETEQTATGVAIELRFAYSLLEKLIQYIDRATINMKMLKPSTTFSRRSSFKTSTRDIKFFSKVVLPLMEKY
FSTHRNYFIAVATATNNVGAASLKEKEMVAALFCKLASLLRSRLTAFGPDVRITVRCLQVLVKGIDAKSLVKNCPEFIRT
SMLTFFNNVADDLGHTIHYLQDGKYSHLRGTHLKTSTSLGYINGVIMPVLTAMFDHLANCEYGADLLLDEIQVASYKMLG
SLFTLGTDSTLTHDRKYLKTEIERHKNALGSCLGAFSSTFPVAFLKPHLNKHNQFSLLNRIADHSLEAQDVMARMEQSMP
TLETILGLVEQFVDSDKTYSDSPHVIDVVLPLLCSYLPFWWAQGPDNVTPSGGNHVTMVTADHMNQLLKNVLKLIKKNIG
NENAPWMTRIATYAQQIIINSSEELLRESFLPLAERVRKRTDNMFHKEESLRGFIKSSTDDTSQVESQIQEDWQLLVRDI
YSFYPLLIKYVDLQRNHWLRNNVNEAEELYNHVAEIFNIWSKSQYFFKEEQNFISANEIDNMVLIMPTATRRVTTVVDGA
PQGGGKVKKKKKHRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRFLKKMTEQDVAEFAKTQLTLPD
KIDPADEMSWQHYLYSKLGSKSKTTTAMETAAENKAKIIDDTVERIVAMSKVLFGLHMIDHPQQMSKNVYRSVVSIQRKR
AVIACFRHLPLHQLPRHRACNIFSRTYYELWLEEENIGQEVMIEDLTQSFEDAELKKSDVEAEGEGKPDPLTQLVTTFCR
GAMTERSGALQEDPLCMSYAHIIAKSCGEEEEEGGEEEEEGAGEAEGEEEGGASIHEQEMEKQKLLFHQARLADRGVAEM
VLLHISASKGVPSDMVMKTLQLGISILRGGNIDIQMGMLNHLKDKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGV
GLEGAAGEKNMHDAEFTCALFRFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKELID
PAGKANFFKAIGVASQVFNTLTEVIQGPCTQNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDMI
TMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLKDLTTSASFAEIDANNDGWVLPKDFKEKMEQQKSYT
PEEIEFLLACCETNHDGKLDYIGFCDRFHEPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEIM
GGSKRIERVYFEIKESNIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHASGLMADAEEAGGGPKN
REAAYMYMGDDDDDSRGKDPFRRGLQSVKDGIATAFSSLSPANMKQKIADMSQMPPQELAVGFFKMFFYLFYYIGYGALV
VVRYIFGVLLGLMRGPQVEEPPPEPTEEEKIGPSRHLPALSATDDQGQMAVSAFGLDITKEDNGQVQIKPHESPGTSSPS
SGEEAETAEDGEHSGDEPQPPSLIDLLGGEQAKKQAQERIEAQAAQQAAMSAIEAESKKAVQAPAPSALSQVDLSQYTRR
AVSFLARKFYTLKYVALVLAFCINFVLLFYKVSTLDAEPGEGSGIGDIISGSGSGSGSGSGDGGSGEEDEDPIELVHIDE
DYFYMEHVIKIAALLHSIVSLAILIGYYHLKVPLAIFKREKEIARKLEFDGLYIAEQPEDDDLKSHWDKLVISAKSFPVN
YWDKFVKKKVRAKYSETYDFDSISNMLGMEKTAFATQEDEGRGFFHYILSIDWRYQVWKAGVTITDNSFLYSLWYFSFSV
MGNFNHFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYVQEEDDDINRNCHDMLT
CFVFNLYKGVRAGGGIGDELEPPDGDDSEAWRIVFDITFFFFIIVILLAILQGLIIDAFGELRDQLESVKEDMESNCFIC
GINKDYFDKVPHGFDTHVQREHNLANYMFFLMHLINKPDTEYTGQETYVWNMYTQRCWDFFPVGDCFRKQYEDAMGE