TCDB is operated by the Saier Lab Bioinformatics Group
>HCO29004.1 TPA: multidrug ABC transporter ATP-binding protein [Lachnospiraceae bacterium]
MYLEIKNITKVIDGTKVLDSITLSMERGKIYGLRGRNGSGKTMIMKAVCGLIRVKEGEIWIDGELLGKKYDFPKSIGALI
ETPGFVENYSGYSNLKMLADMKGFIGKKEIEMIMERVGLDPKEKKKVKKYSLGMRQKLGIAAALMEHPELIVLDEPTNAL
DEESVQVLHCLLQEEKDRGALIMISSHDEEELKLLCDEIYIVNAGKVKKKLEQIPEGKQNNWEEVE