TCDB is operated by the Saier Lab Bioinformatics Group
>HCO29006.1 TPA: hypothetical protein DIT54_06250 [Lachnospiraceae bacterium]
MKDKEIRRNLPSFEKFIDYSKLYGAAFLYCLFFGYKGISMFPIQSEILCRRDVFVTMTYPLWYSLIFLLPITITTISIVK
YDFLPMCVIQNHSWKSLLWKQQKKIGMQSLFYSSVFLVVIFFWTSGMTVSNWERMGSYFYQKTDSTSQVITIEFFIIIFI
VCFIRNYIMGQILLLSLWKKATPVYGVLLLCGIICFEMAIAKYPILFRLLTIDYFMWVDKTTRIKIVGGVLLYLIIFAIC
FRQIVKKKEWIRYEKI