TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I7I1R6|I7I1R6_LEGPN Putative to nasA protein OS=Legionella pneumophila subsp. pneumophila GN=phtK PE=4 SV=1
MSVSRVTAWFVWVIVSIFYAYQYVLRVMPNIMLDDITQQFHIDAIIFGQFSGIYYIGYSLMHLPIGIMLDRFGPRKVMTG
CIMLTVIGLLPILFAENWVYPVIGRALIGIGSSAAILGTFKIIRMTFKEKHFPRMLSFSVMIGLVGAVYGGGPVSYMCQL
MGYKMVVEIFVGIGIVLAGITYLIVPDVQPSRQDSVISNIRMVFGNSKVILLCCFAGLMLGPLEGFSDVWGSGFLKMAYS
LNTNAANYLPSMIYIGMCFGAPVLSLIAEKTGYYLGTIIASGVVMFLVFAMLVGGVLTVPSITISFILVGICCSYQILAI
YKVSTYVPDNLAGLTTAIANMIIMIFGYGFHSVIGYVVNMYGGTHVARAFVYGVGVIPLTLAVGVVGFLFLAYQEKNFTP
DASFASPELR