TCDB is operated by the Saier Lab Bioinformatics Group
>tr|I7MMI7|I7MMI7_TETTS ATP synthase F1, delta subunit family protein OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_00684790 PE=3 SV=1
MQVIRKHLAQKGLFNPFLFNRFSTQQDITSVPGDKPPAIEDSIHGKYAGVLFSSASSNKSLNKVAEDMKYFNQLYKESEV
FKSFLNNVSLKRNQQRDIISALGKTNFNPATNNLLETLIENKRLDSLPKIAEKYMDYYRILNKQESITIISAQELTAAEK
QKVEQGLKKGNANVQFTVVYQVDPAILGGLQMYSGNNFLDCSLLSRVNKLKTEIAKISF