TCDB is operated by the Saier Lab Bioinformatics Group
>tr|J7IPE5|J7IPE5_DESMD Uncharacterized protein OS=Desulfosporosinus meridiei (strain ATCC BAA-275 / DSM 13257 / NCIMB 13706 / S10) GN=Desmer_1487 PE=4 SV=1
MKIILPPPLADPPAGQSFRQDFVLLLKNQMRVSWNKMRHRPIGALLGMAVLVLGLIALLSSLGYFAYGALKTMPPQTVKG
FLSLLFMGGLASQVFFGITAAFAALYMSEDLELLFMAPVSIKAVFAVKSLAVVGSNFLTALLFAFLPGVFYGLLFQAGAS
FYILVALVGLGIWALGTAIAELINLLIMRIVPPHRSKEAVGFIGALAGILIAIVFQIPNMLINSEEELNLGAWIAGQEQM
LGIMDYFPWGWGSLALVSGISGDFIAGLGWSLLIMVVGVLLFLLAFNLVERGFRRGFISLSQGEGGRRRRKGISAEQGKV
HPQRELVSYSLFEKEVSHTAPPWFGMWAVAKKDLLSMKRDTREWFGYLVPLIIMLFFVGQFLFSQVKSSQASLITVLIMY
TVMFSGNLALQSFGREGESDWLLNSVPLAGWPVVWGKLLAAILPTLLLMETLLVGTALAIGVSTSLIFALAFGAVLLSLG
SSAIGLFYSINNCRYNPDTPQQRISPGASLFMYLINLFFILLLALGLIYVFLPEELIVMLRDLPPVTFKGGFLSGLSYVL
YLLSRPLLWTTSLRIILGIVVTSGVWSLMFFGFMAATVRQSRKGFRVELVTGSKKKKLWKKRKTQIS