TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O05870|PSTS2_MYCTU Phosphate-binding protein PstS 2 OS=Mycobacterium tuberculosis GN=pstS2 PE=1 SV=1
MKFARSGAAVSLLAAGTLVLTACGGGTNSSSSGAGGTSGSVHCGGKKELHSSGSTAQENAMEQFVYAYVRSCPGYTLDYN
ANGSGAGVTQFLNNETDFAGSDVPLNPSTGQPDRSAERCGSPAWDLPTVFGPIAITYNIKGVSTLNLDGPTTAKIFNGTI
TVWNDPQIQALNSGTDLPPTPISVIFRSDKSGTSDNFQKYLDGASNGAWGKGASETFNGGVGVGASGNNGTSALLQTTDG
SITYNEWSFAVGKQLNMAQIITSAGPDPVAITTESVGKTIAGAKIMGQGNDLVLDTSSFYRPTQPGSYPIVLATYEIVCS
KYPDATTGTAVRAFMQAAIGPGQEGLDQYGSIPLPKSFQAKLAAAVNAIS