TCDB is operated by the Saier Lab Bioinformatics Group
>tr|O52557 RIFAMYCIN EFFLUX PROTEIN - Amycolatopsis mediterranei (Nocardia mediterranei).
MHATAAVTETRNPRRWLILAVISLAQLVVLVDNTVLNLAIPKLTEDLGATTADIQWMINAYALVQSGLLLTAGSFSDRYG
RKRSLLAGLLLFGVGSLAAAFSLSSGQLIAARAGMGIGGALLTTTTLAVVMQVFDEKELPKAIGLWSAVSSFGYASGPLI
GGALLAHFWWGSIFLINIPVALLGCVAVAKLVPESKDPQGARPDLVGAALSTIGMAGIVYAIISGPEHGWASATVLVAAG
IGVAALAAFVRWELHVPHPMLDMGLFRNRRFNGAISGGLLVAFGMGGSVFLLTQQLQLVLGYDPLEAGLRTAPLALVVVA
LNVAGLGAKLLEKLGIAMTIAVGMTLNAVGLAMVAVLGTPDRGFGGMLACLLVMGGGIAPAMPAMANAIMTSIPAEKAGA
GAAVQGTVNQFGSGLGVAILGAVLNSRFAALLPIGLGAGAAGSLHEALLQARTPALQAQVRDAFAGGVRASELIGALAVV
LGGMLAGMLLRRAARSEAHQAAWARPTIRLEAAPAPFTVDLR