TCDB is operated by the Saier Lab Bioinformatics Group
>sp|O95807|TM50A_HUMAN Transmembrane protein 50A OS=Homo sapiens GN=TMEM50A PE=1 SV=1
MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACGVIATIAFLMINAVSNGQVRG
DSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYVAKEKDIVYPGIAVFFQNAFIFFGGLVFKFGRTEDLWQ