TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P04816|LIVK_ECOLI Leucine-specific binding protein precursor (LS-BP) (L-BP) - Escherichia coli.
MKRNAKTIIAGMIALAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQ
AVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVK
PQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVG
LKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSD
EPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTAAK