TCDB is operated by the Saier Lab Bioinformatics Group
>P0A4W2|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein cysA - Mycobacterium tuberculosis.
MKMTYAIVVADATKRYGDFVALDHVDFVVPTGSLTALLGPSGSGKSTLLRTIAGLDQPDTGTITINGRDVTRVPPQRRGI
GFVFQHYAAFKHLTVRDNVAFGLKIRKRPKAEIKAKVDNLLQVVGLSGFQSRYPNQLSGGQRQRMALARALAVDPEVLLL
DEPFGALDAKVREELRAWLRRLHDEVHVTTVLVTHDQAEALDVADRIAVLHKGRIEQVGSPTDVYDAPANAFVMSFLGAV
STLNGSLVRPHDIRVGRTPNMAVAAADGTAGSTGVLRAVVDRVVVLGFEVRVELTSAATGGAFTAQITRGDAEALALREG
DTVYVRATRVPPIAGGVSGVDDAGVERVKVTST