TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0A627|PSTA2_MYCBO Phosphate transport system permease protein PstA 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pstA2 PE=3 SV=1
MGESAESGSRQLPAMSPPRRSVAYRRKIVDALWWAACVCCLAVVITPTLWMLIGVVSRAVPVFHWSVLVQDSQGNGGGLR
NAIIGTAVLAIGVILVGGTVSVLTGIYLSEFATGKTRSILRGAYEVLSGIPSIVLGYVGYLALVVYFDWGFSLAAGVLVL
SVMSIPYIAKATESALAQVPTSYREAAEALGLPAGWALRKIVLKTAMPGIVTGMLVALALAIGETAPLLYTAGWSNSPPT
GQLTDSPVGYLTYPIWTFYNQPSKSAQDLSYDAALLLIVFLLLLIFIGRLINWLSRRRWDV