TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P0AFR7|YCJO_ECOLI Inner membrane ABC transporter permease protein YcjO OS=Escherichia coli (strain K12) GN=ycjO PE=1 SV=1
MNRLFSGRSDMPFALLLLAPSLLLLGGLVAWPMVSNIEISFLRLPLNPNIESTFVGVSNYVRILSDPGFWHSLWMTVWYT
ALVVAGSTVLGLAVAMFFNREFRLRKTARSLVILSYVTPSISLVFAWKYMFNNGYGIVNYLGVDLLHLYEQAPLWFDNPG
SSFVLVVLFAIWRYFPYAFISFLAILQTIDKSLYEAAEMDGANAWQRFRIVTLPAIMPVLATVVTLRTIWMFYMFADVYL
LTTKVDILGVYLYKTAFAFNDLGKAAAISVVLFIIIFAVILLTRKRVNLNGNK