TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P23462|PUCC_RHOCA PROTEIN PUCC - Rhodobacter capsulatus (Rhodopseudomonas capsulata).
MGYRAFALKNLARHAPKYLPFADVASEEVPLSRLLRLSLFQITVGMTLTLLAGTLNRVMIVELAVPASLVSVMLAMPMLF
APFRTLIGFKSDTHKSALGLRRAPWIWKGTIYQFGGFAIMPFALLVLSGFGESVDAPRWIGMSAAALAFLLVGAGVHIVQ
TAGLALATDLVAEEDQPKVVGLMYVMLLFGMVISALVYGALLADYTPGRLIQVIQGTALASVVLNMAAMWKQEAVSRDRA
RQMETAEHPTFKEAFGLLMGRPGMLALLTVIALGTFGFGMADVLLEPYGGQALHLTVGETTKLTALFALGTLAGFGTASR
VLGNGARPMRWSAGCTDRVPGFVAIIMSSLISQDGIWLFLAGTFAVGLGIGLFGHATLTATMRTAPADRIGLALGAWGAV
QATAAGLGVALAGVVRDGLVALPGTFGSGVVGPYNTVFAIEALILIVAIAFAVPLLKRGGR