TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P29993|ITPR_DROME Inositol 1,4,5-trisphosphate receptor OS=Drosophila melanogaster GN=Itp-r83A PE=2 SV=3
MGDNIIGSASFLHLGDIVSLYAEGSVCGFLSTLGLVDDRTVVCPEAGDLSCPPKKFRDCLIKICPMNRYSAQKQFWKAAK
QSASSNTDPNLLKRLHHAAEIEKKQNETENKKLLGTSIQYGRAVVQLLHLKSNKYLTVNKRLPSLLEKNAMRVYLDANGN
EGSWFYIKPFYKLRSIGDYVVVVGDKVILSPVNADQQNLHVAANYELPDNPGCKEVNVLNSSTSWKISLFMEHKENQEHI
LKGGDVVRLFHAEQEKFLTMDEYKKQYHVFLRTTGRTSATAATSSKALWEIEVVQHDSCRGGAGDWNSLYRFKHLATGHY
LAAEAEIDVSAGAMSATSASGHDLHLGDCSKDSGLSCSTMNSTINDKPKGKQYRLVSVPYSADIASVFVLDATTMARPDS
LVPQSSYVRLQHICSNTWVHATSIPIDADDDKPVMSMVCCSPIKEDKEAFALIPVSPVEVRDLDFANDACKVLATVTSKL
DNGSISINERRALISLLQDIVYFIAGMENEQNKTKALEFTIKNPIRDRQKLLREQYILKQLFKILQGPFQEHTAGDGPFL
RLDELSDPKNSPYKNIFRLCYRILRLSQQDYRKNQEYIAKHFGLMQKQIGYDILAEDTITALLHNNRKLLEKHITAAEIE
TFVGLVRKNMHNWDSRFLDYLSDLCVSNRKAIAVTQELICKSVLSDKNKDILIETQVKALRTGSGPVRCYKGNSEDVCLA
TLAEDPGDDEDRSDVQSTSTTTTWDSASLNEDDGTPSTGDKYEIHLKWTGQPTSRSMADLASCDGGELEAAILNYYRHQL
NLFSNMCLNRQYLALNELSPRLDIDLILKCMSDETMPYELRASFCRLMLHLHVDRDPQEPVTPVKYARLWSEIPSKMSIQ
DYDGKNQQPDQNKQACRAKFNTTIAFVENYLCNVATKVWLFTDQEQNKLTFEVVKLARDLIYFGFYSFSDLLRLTKTLLS
ILDCVSDTSSGEFASTDIDSVEEETNAEAEGGVLRSIGDINTVMTSLALGSVGQAIAAPTISLQQRKSVSQLMKEYPLVM
DTKLKIIEILQFILDVRLDYRISCLLSIFKREFDESEVAASAASNEASQQQSQQQEPQTPGSSNETDPLDSAESVAAGAA
AAAATTARQKNIDLESIGVQAEGIFDCERSDAANLDLDGQGGRTFLRVLLHLIMHDYAPLVSGALHLLFRHFSQRQEVLQ
AFRQVQLLVSDSDVESYKQIKSDLDILRQSVEKSELWVYKAKATDELGATDAGGDAVSLEYNAALSQEQRNEYRKVKEIL
IRMNKFCVTASGPGSVVKPRKHEQRLLRNVGVHTVVLDLLQNPYDEKDDELMKELMCLAHEFLQNFCLGNQQNQVLLHNH
LDLFLNPGILEAKTVCAIFKDNLALCNEVTDKVVQHFVHCIEIHGRHVAYLQFLQTVVAAENQFIRRCQDMVMQELINSG
EDVLVFYNDKGSFNHFVQMMQQQMLGMEKLSDDSPLKYHVELVKLLACCTMGKNVYTEIKCNNLLSLDDIVTIICHPLCM
PEVKEAYVDFLNHCYIDTEVEMKEIYASGHMWSLFEKSFLVDINQLITNPAAASNKTLQAYVLNGVTNLLGSFFASPFSD
QSAIVQSRQLIFVQLLQAAHRITQCRWLSLGDRFNVENCIRTLTESAKMRSIALPPELEQQVATMSSKTAMLTRQTTKWL
LASKQPKYEAQQAASLMRWDRSIIEGLQDIVSLLEDQLKPVVEAELSLLVDILYRSELLFPAGTEARKRCESGGFIRKLI
KHTEKLLEEKEERMCVKVLRTLREMMAIDVNYGEKGDALRQTLLLRYFQTKSTPRLPEDEVPLLAAPLMDPAKQNHLVTH
GPGAKYLQRAGKTLHEMQNHLDREGASDLVVELVIKSVHSPNIFVEAVELGIALLEGGNPIIQKGMFQKFLSDDLNQAFF
KVFFEKMKDAQQEIKSTVTVNTTDIAAKAHEHKQDTNLELDKIARKHGLKSNGVVITEELKRELHNAGLATARAYGNARN
IHSGEESSAISVNSPLEDILAEKLEKHKDSRDQRNQLSNKVLVMQPILRFLQLLCENHNPDMQNLLRNQNNKTNNNLVSE
TLMFLDCICGSTTGGLGLLGLYINEHNLALINQTLEALTEYCQGPCHENQNCIATHESNGLDIITALILNNINPLGENRM
DLVLELKNNASKLLLAIMESRGDSENAERILYNMNPKQLVEVACKAYHQEELIDEQDDGDEPDAGSDDDDATVSPREVGH
NIYILCHQLAQHNKELAGLLKASEDPQSASFDAKTSQALMYYATHTAQIEIVRNDRTLEQIVFPIPEICEYLTTDTKIKI
LNTAERDDQGSKLADFFDKAEEMFNEMKWQKKLRSQPLLFWISSYMSLWSNILFNCVVVINMIVAFFYPFDNTVPELSSH
ISLLFWIITIFSLVIVLALPRESGIRTFIGSVILRFIFLLGPESTLCLLGVVTVTLKSVHIVSIMGNKGTLEKQLIKIIT
DFQLLYHCIYIAFCFCGLIFHPFFYSLLLFDVVYREETLVNVIRSVTRNGRSIVLTAVLALILVYLFSIIGYMFFKDDFL
VSVDFEEQDNAPPPSVPLTLSVPVSGDSCSAPDDLGNCQAAKEVAPPSAGGGEVKERSCDSLVMCIVTTLNQGLRNGGGI
GDILRAPSSKEGLFVARVIYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKEAILKTTCFICSLNRSAFDNKTVSFE
EHIKSEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKAGILEWFPRLRAMSLAAVDADGEQIELRSMQAQLLDTQLLI
KNLSTQLHELKDHMTEQRKQKQRLGLLNTTANSLLPFQ