TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P37594|SMVA_SALTY Methyl viologen resistance protein smvA - Salmonella typhimurium.
MFRQWLTLVIIVLVYIPVAIDATVLHVAAPTLSMTLGASGNELLWIIDIYSLVMAGMVLPMGALGDRIGFKRLLMLGGTL
FGLASLAAAFSHTASWLIATRVLLAIGAAMIVPATLAGIRATFCEEKHRNMALGVWAAVGSGGAAFGPLIGGILLEHFYW
GSVFLINVPIVLVVMGLTARYVPRQAGRRDQPLNLGHAVMLIIAILLLVYSAKTALKGHLSLWVISFTLLTGALLLGLFI
RTQLATSRPMIDMRLFTHRIILSGVVMAMTAMITLVGFELLMAQELQFVHGLSPYEAGVFMLPVMVASGFSGPIAGVLVS
RLGLRLVATGGMALSALSFYGLAMTDFSTQQWQAWGLMALLGFSAASALLASTSAIMAAAPAEKAAAAGAIETMAYELGA
GLGIAIFGLLLSRSFSASIRLPAGLEAQEIARASSSMGEAVQLANSLPPTQGQAILDAARHAFIWSHSVALSSAGSMLLL
LAVGMWFSLAKAQRR