TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P37643|YHJE_ECOLI Inner membrane metabolite transport protein yhjE OS=Escherichia coli (strain K12) GN=yhjE PE=1 SV=1
MQATATTLDHEQEYTPINSRNKVLVASLIGTAIEFFDFYIYATAAVIVFPHIFFPQGDPTAATLQSLATFAIAFVARPIG
SAVFGHFGDRVGRKATLVASLLTMGISTVVIGLLPGYATIGIFAPLLLALARFGQGLGLGGEWGGAALLATENAPPRKRA
LYGSFPQLGAPIGFFFANGTFLLLSWLLTDEQFMSWGWRVPFIFSAVLVIIGLYVRVSLHESPVFEKVAKAKKQVKIPLG
TLLTKHVRVTVLGTFIMLATYTLFYIMTVYSMTFSTAAAPVGLGLPRNEVLWMLMMAVIGFGVMVPVAGLLADAFGRRKS
MVIITTLIILFALFAFNPLLGSGNPILVFAFLLLGLSLMGLTFGPMGALLPELFPTEVRYTGASFSYNVASILGASVAPY
IAAWLQTNYGLGAVGLYLAAMAGLTLIALLLTHETRHQSL