TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P52067|FSR_ECOLI Fosmidomycin resistance protein - Escherichia coli.
MAMSEQPQPVAGAAASTTKARTSFGILGAISLSHLLNDMIQSLILAIYPLLQSEFSLTFMQIGMITLTFQLASSLLQPVV
GYWTDKYPMPWSLPIGMCFTLSGLVLLALAGSFGAVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFG
SSLGPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYSAQHRMNKGKPKATIINPLPRNKVVLAVSILLILIFSKY
FYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTVIGGPVGDKIGRKYVIWGSILGVAPFTLILPYASLHWTGV
LTVIIGFILASAFSAILVYAQELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIELVYKICAFLPLLGMLTIFLP
DNRHKD