TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P54715|PTIB_BACSU PTS system, arbutin-like IICB component (Phosphotransferase enzyme II, CB component) (EC 2.7.1.69) - Bacillus subtilis.
MMQKIQRFGSAMFVPVLLFAFAGIIVGISTLFKNKTLMGPLADPDGFWYQCWYIIEQGGWTVFNQMPLLFAIGIPVALAK
KAQARACLEALTVYLTFNYFVSAILTVWGGAFGVDMNQEVGGTSGLTMIAGIKTLDTNIIGAIFISSIVVFLHNRYFDKK
LPDFLGIFQGSTYIVMISFFIMIPIALAVSYIWPMVQSGIGSLQSFLVASGAVGVWIYTFLERILIPTGLHHFIYTPFIY
GPAVAEGGIVTYWAQHLGEYSQSAKPLKELFPQGGFALHGNSKIFGIPGIALAFYVTAKKEKKKLVAGLLIPVTLTAIVA
GITEPIEFTFLFISPFLFAVHAVLAATMSTVMYMAGVVGNMGGGLIEAVTLNWIPLFGSHGMTYVYQILIGLSFTAIYFF
VFRFLILKFNIATPGREKDEQQETKLYSKKEYRERKNKDETASAAETADDTAFLYIEALGGKDNITEVTNCATRLRVSVK
DETKVEPDSVFRALGAHGVVRNGKAFQVIIGLSVPQMRERVEKILNQ