TCDB is operated by the Saier Lab Bioinformatics Group
>tr|P71746 Hypothetical 29.3 kDa protein (Sulfate ABC transporter, permease protein) - Mycobacterium tuberculosis.
MTSLPAARYLVRSVALGYVFVLLIVPVALILWRTFEPGFGQFYAWISTPAAISALNLSLLVVAIVVPLNVIFGVTTALVL
ARNRFRGKGVLQAIIDLPFAVSPVIVGVSLILLWGSAGALGFVEQDLGFKIIFGLPGIVLGSMFVTCPFVVREVEPVLHE
LGTDQEQAAATLGSGWWQTFWRITLPSIRWGLTYGIVLTVARTLGEYGAVIIVSSNLPGTSQTLTLLVSDRYHRGAEYGA
YALSTLLMAVSVVVLIVQMVLDARRARAVSEG