TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P76042|YCJN_ECOLI Putative ABC transporter periplasmic-binding protein YcjN OS=Escherichia coli (strain K12) GN=ycjN PE=3 SV=1
MIKSKIVLLSALVSCALISGCKEENKTNVSIEFMHSSVEQERQAVISKLIARFEKENPGITVKQVPVEEDAYNTKVITLS
RSGSLPEVIETSHDYAKVMDKEQLIDRKAVATVISNVGEGAFYDGVLRIVRTEDGSAWTGVPVSAWIGGIWYRKDVLAKA
GLEEPKNWQQLLDVAQKLNDPANKKYGIALPTAESVLTEQSFSQFALSNQANVFNAEGKITLDTPEMMQALTYYRDLTAN
TMPGSNDIMEVKDAFMNGTAPMAIYSTYILPAVIKEGDPKNVGFVVPTEKNSAVYGMLTSLTITAGQKTEETEAAEKFVT
FMEQADNIADWVMMSPGAALPVNKAVVTTATWKDNDVIKALGELPNQLIGELPNIQVFGAVGDKNFTRMGDVTGSGVVSS
MVHNVTVGKADLSTTLQASQKKLDELIEQH