TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P77716|YCJP_ECOLI Inner membrane ABC transporter permease protein YcjP OS=Escherichia coli (strain K12) GN=ycjP PE=1 SV=1
MATNKRTLSRIGFYCGLALFLIITLFPFFVMLMTSFKGAKEAISLHPTLLPQQWTLEHYVDIFNPMIFPFVDYFRNSLVV
SVVSSVVAVFLGILGAYALSRLRFKGRMTINASFYTVYMFSGILLVVPLFKIITALGIYDTEMALIITMVTQTLPTAVFM
LKSYFDTIPDEIEEAAMMDGLNRLQIIFRITVPLAMSGLISVFVYCFMVAWNDYLFASIFLSSASNFTLPVGLNALFSTP
DYIWGRMMAASLVTALPVVIMYALSERFIKSGLTAGGVKG