TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster OX=7227 GN=Mdr65 PE=1 SV=2
MERDEVSTSSSEGKSQEEAPMAEGLEPTEPIAFLKLFRFSTYGEIGWLFFGFIMCCIKALTLPAVVIIYSEFTSMLVDRA
MQFGTSSNVHALPLFGGGKTLTNASREENNEALYDDSISYGILLTIASVVMFISGIFSVDVFNMVALRQVTRMRIKLFSS
VIRQDIGWHDLASKQNFTQSMVDDVEKIRDGISEKVGHFVYLVVGFIITVAISFSYGWKLTLAVSSYIPLVILLNYYVAK
FQGKLTAREQESYAGAGNLAEEILSSIRTVVSFGGEKSEVQRYENFLVPARKASQWKGAFSGLSDAVLKSMLYLSCAGAF
WYGVNLIIDDRNVENKEYTPAILMIAFFGIIVGADNIARTAPFLESFATARGCATNLFKVIDLTSKIDPLSTDGKLLNYG
LRGDVEFQDVFFRYPSRPEVIVHRGLNIRIRAGQTVALVGSSGCGKSTCVQLLQRFYDPVFGSVLLDDLDIRKYNIQWLR
SNIAVVGQEPVLFLGTIAQNISYGKPGATQKEIEAAATQAGAHEFITNLPESYRSMIGERGSQLSGGQKQRIAIARALIQ
NPKILLLDEATSALDYQSEKQVQQALDLASKGRTTIVVSHRLSAIRGADKIVFIHDGKVLEEGSHDDLMALEGAYYNMVR
AGDINMPDEVEKEDSIEDTKQKSLALFEKSFETSPLNFEKGQKNSVQFEEPIIKALIKDTNAQSAEAPPEKPNFFRTFSR
ILQLAKQEWCYLILGTISAVAVGFLYPAFAVIFGEFYAALAEKDPEDALRRTAVLSWACLGLAFLTGLVCFLQTYLFNYA
GIWLTTRMRAMTFNAMVNQEVGWFDDENNSVGALSARLSGEAVDIQGAIGYPLSGMIQALSNFISSVSVAMYYNWKLALL
CLANCPIIVGSVILEAKMMSNAVVREKQVIEEACRIATESITNIRTVAGLRREADVIREYTEEIQRVEVLIRQKLRWRGV
LNSTMQASAFFAYAVALCYGGVLVSEGQLPFQDIIKVSETLLYGSMMLAQSLAFTPAFSAALIAGHRLFQILDRKPKIQS
PMGTIKNTLAKQLNLFEGVRYRGIQFRYPTRPDAKILNGLDLEVLKGQTVALVGHSGCGKSTCVQLLQRYYDPDEGTIHI
DHDDIQHDLTLDGVRTKLGIVSQEPTLFERSIAENIAYGDNRRSVSMVEIIAAAKSANAHSFIISLPNGYDTRMGARGTQ
LSGGQKQRIAIARALVRNPKILLLDEATSALDLQSEQLVQQALDTACSGRTCIVIAHRLSTVQNADVICVIQNGQVVEQG
NHMQLISQGGIYAKLHKTQKDH