TCDB is operated by the Saier Lab Bioinformatics Group
>Q03RZ6|Q03RZ6_LACBA ABC-type antimicrobial peptide transport system, ATPase component - Lactobacillus brevis (strain ATCC 367 / JCM 1170)
MATLQLKDIHKSYYLGKEEFPVLKGIDLDFNLGEFVSILGESGGGKSTLMNIIGGLDREFQGEVQLKGKPIDHRNEKSLD
RFRRETIGYIYQAYNLVNHLTVLDNVLISLDMTTLTKEQRVDRANHLLERVGLAEQAKKYPNQLSGGQKQRVAIARALAS
DPQIIIADEPTGALDSQNTAEVLDILNDIAKEGRLVITVTHSQAVADAGTRIVQLVDGKIDSDTSIRQPYPVTGDAERLT
ARKLPARVSYQTAFKHFKFTFGQNFLIMLGTAIGLFAVILFSGLGNGLSGYINEQITNVANPQVVSVSRHTRSTSNANKQ
QTQAESQRAAMGMGTTTAKPKTFSQTQISQIRQLKHVTKVEKSYSLTDVKIKHGKKSVTTSTASNWTSSATTSSIKVGHK
PQAGEIVLDKTAVAKQLNKKDWKSLIGKTVTVSYSTANANNRPTKVTFKAKVAGIAESSTGAMSITAVNTNTLVKALNKA
NVSTKPAALAVSIDKLGSVNGVVKQINKLKNDGTKLYAATSITSLISTVQTYVHLASSILAAIAAISLIVSALMIIVTMY
MSVSARTKEIGILRALGESKADIRRLFISESLIIGVLSAVLATVIALGLGALANTMLSKIASYAFIQITLGNIITTFVIA
IVIALIAAYLPARHAASLNPIDALSAD