TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q03S56|Q03S56_LACBA Uncharacterized protein OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=LVIS_0823 PE=4 SV=1
MKTMAKTQLPKLDTLSMVTMGVLMALQLVISRFSVGNNFIKVSFTFLIVALIAKWFGPWWGMLTAAVVDVIGTLMTGGPF
FIGFTVSAVLGSLIYAVFLYRQPVSWWRVIGASVLIALLVNTLLNTLWVTIMYQTPFWSLLPVRALKELIVTPVQIVLVY
LLLKSQVIQMIQARLNK