TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1DCT0|Q1DCT0_MYXXD ABC transporter, permease/ATP-binding protein OS=Myxococcus xanthus (strain DK 1622) GN=abcA PE=3 SV=1
MRVEHAAGLRAEHIADLVDAAIREALEDIAPDTDSRALESTRNAPPRIRVLVVALAVSASGYVVHSVVGSAMRIFPRWSV
WGGIGALLGTSAAVIHAADDDVEDETRTQRDHALRELLKASRPYHRMLLLAMAATVVSRAMQVGYVALVGVLTDSLLSPH
RVMLFGRRLPIGRLGLGKVAAGLVALIAGCSFFEYVSRILWMRAAHRITHDLRLRLYEHVQSLELKAFADTSRGNYLTLL
NEDLNRIELLFSSTWGVWNEVAYATCSTVGFFLVSPGFAGLAAVPMPALLLLAQSLEKRIRPRYAALRQQAGVLQGVLNN
NIDGIPTIRAFGAERMAARWVDEASVGFRGEQDAATQIHSSYNPVVLAAANTLRMVTALAAGFHASRGHLTPGTYVSLVI
LSTSLSLPMLSVARDFPHILSTLASLSRVFKAFELPRERRDEGAALDAGAVRGAIRVEDVRFGYHPGLPVLDGFSVDIPA
GKMTAFVGETGSGKSTLAKLLLRFHDADAGHILLDEQDIAGLRRGDVRRAIAYVGQDIFLFNGSIRDNIAFGMPDVGLEA
IQEAAQRAGAHEFIMQLPQGYASHTGELGQKLSGGQRQRIGIARALLLRRPILILDEVTSSLDAVTEAQLLRAWSEVLAG
RTVIVVAHRLSAVRDAHRIHVLERGRIAESGSHEELLGRGGRYARYWDLQVNQKELPPDAFPGRGGLPS