TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q25BZ4|Q25BZ4_SELRU Major envelope protein OS=Selenomonas ruminantium GN=mep45 PE=4 SV=1
MKKTLVSALTTALVVGAASTTFAASNPFSDVPADHWAYDAVAQLAADGVVEGYGDSTFKGNRNITRYEMAQMVAKAMAKN
TSGTDKALVDKLAAEFAEELNNLGVRVSNLERNADMVKWNGVAEYTFTRQRHEKNGKKTTNHGDDNVLFRLEPSAEVNSH
WHVKARLDANSNLKSDQGEDSSSVKLKRVWAQGEYGKLTVKLGKFASLNDDTFADTPFSGAEVSYGKDVKVIAAAGRLNL
WDASAFKKNVDIQNVRNWMVAGRHDDRTANYQYAGLELNKSKLSGGLYWHHLNAAGFDYKKGTTDEANIGAVKGSYTFSK
NVSVNGFYTQNFDVDTKNYQDKSASLEVDYKGAQQENKGTWGAWVAYRRLGNAAIINNTYDVINTGYKGWEVGGNYTLFK
NVVTTLRYGNQKDISNSNVKDQNFFGRVQFFF