TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q3SDX7|Q3SDX7_PARTE Inositol 1,4,5,-triphosphate receptor n-2 OS=Paramecium tetraurelia GN=IP3Rn-2 PE=4 SV=1
MEIIKIGSIVSISHLQDDDALIGGDGFIKNAVILKGMSPLNKLDTKDFNISYFSQMNIPNCLFVVCPRTSNGKKVEVAKI
FPQRKKKPFGSINDDVTDQKSEVTPVRSQIKSVTHSVQPLLSEKQVRDNQMNLFNEFKFNVDGFEKEKGNYVKYEEPIQL
LHLASSKWLCSLLDEAKFENQNFKLALSDYTSDETLFKIVATYKYQKEGDQIVYSQEIVRIMRMIPFLGKPTYLHCSGEI
PQKAIKEYRENSEVKIQKREINASLEESTSWKINLFAEELPIDGDLVWIHHSETCSQLAVDYERDLNRAKISVFQTDLSE
LSFDNYSGNAYSMWIIEGEDYKKGGPYLYSNNYRLKHFHTGLYLACVRVIPKEQEDIKIDPYGKKKVIIPKSKKVPATFA
LQVQPNKDSLFRFEPLKSVNKDEIQSDFIQIRSVTQGKYLDVINKFHQDENTLKPVILNQKNEHAVFKIFRANKQETQEV
LFLDSCTKQLRKYQFYINLLFKFEQNQMYQSLSDDVELLKIKTKKLATAQRCIQNLDDFLRQKIYNSSPSQKYGFISPKR
QKLLKDQHFFDVLLQILTSTVTKQELEIWSNKKGNLKALEQPSMTEKNQRKQQTISEKDKLELSNSKVEVCNMIFVLLQT
SVINNTSNQLYLFERLPDYQHYCKYLPQTINFLIEMVKSNEKILINLCNNLKIEFDYIKKQEIEDDLKNKVKVLINFYEK
DAGIQQDVSIPVKVHDRIITRPINIIQYFFNLIIDDTAKNNEHYLRFLRHICRYKNNAISINQENLFKLYKKYNKQTKLL
QIETNNGCIIDKEISFQYELLQFFSEVSYGRNYLWQAELSPLFEKDILINQIWNPNQVEGNQIDDKLRSYWCRLSRTLYI
DQQPFQYLIVPNFCRLYSPYQDQLKNRNDEEIEKQFKLKKMFKYIKTKRSEVYEAIASRASSDLLNDELVYNAADQILTM
LQLDIMPNKYYNKIIKYMSEMFIYDRKNLDYLNAAVKSYQKTVTERKSKKSIVINQFGNVFSGMKDLIQLKQEDKEEIAE
EEEDEEINLYDQPKLFLNPIMKGFMAMSNQLEGLITLPKSQQEIEFKLKVCSILDHFLDRRQNFLISNILLFFLKYQYTN
DDLSDEDDDQTIKAAPKIFNNNYKTLIPTIARTGIDEIDEPEDTTQDFLQMAVKKPPTFTNYFQQYNIKSEDEFQELDYY
LSQAQKFDNNERLSEDQLKEKQVASLLPYLMSTYFLVKDQVLEERCLNVIMRVFNQREELRENMKKLQILFDDDNIKIYE
FVEHLQKDLRVMVEKTEIWLTQFRAGYDVEELDKCAQIIRQLTLCMRQGVQVNDRELVVEVVNKEINDSEKQSIMTFLKI
HEIVINLIQNGMAHFISVLNDEFIKIERKEQLLLLFSNAFKFLICYCTNNKGNQLILYQYLEIYLQFIQYDVGQCKLLIE
IFRDNPRLLNTGVKSLVQRLIEIIEREGRQVKFVEILLNLISIAGQYLLENQILILNTFLPMRSLKETEQRLLYAEGSQQ
KDLRFYFDDQFLEPEENLIKQLEAIDWKDCYRDEPFLYHSKILDLLLQTSLIDNTVREYNPSLMPTDNFNISVFKLKKMI
KPSYLLEILRLDDDMVSLKQRLARMPTQFIKGQASQYQDEQFNKKKGYTALKPIVCEFLRLVHIVSEKNNAQEGLLSQLS
RQFIHFVEFESKKLEFVAAGTDYQNCYVDYIIGQVIPLILCYHQRVLSVQQEDVKNALIEFSSQFAQALCSTFYQKLTKY
EQLEIISKLREYYQNEYYEPAYRQEGEQSILHLQHMQFQLEDGEDLQQPIEEQHVQSIQKKSQSKSKNLLSQFASLNLSL
INKTSKHKRGDLTPIKLQEQWKRFAEELFRSPKLEEQIDIEKEALADAIIGIDKLIQEPCEIKPSLESILKKFITFLQTA
VLQQDNKGTIVILLKIMSKIIEKQDSDEKKEYYQKLFDNLGATRMVLNVITDYSKLLSNEMLYYLISFINVLLRNGNSQV
QNTIFTFCQTQQKSEVMFQTFAKYLEIAATSGRDKNEDKEEAEVQKQIVNCILKFFQNCTEGHYQDMQNYIRYQYNSRAS
KDLINLVADLFKNYDRTKQNFSNLMCCLDTLNELVQGPCAENQLAVADSKFFDVVQEMFPLRKGAVSQQKAVKSAATKRI
SVLPSQSVSNLLTRGMKAQLQNKILVLVLSLLENREIKGKNSIIKRIMRVLPMNVLERHLSKIYKKWFNKYTGDYNMQAF
ELLKIDAMDLDEESQEFKDCEIIIQNGFYIMFLICYYMESDEEIDSVFMGYNKQYLKSQIQQNSLFDPNSTLGQLFALGM
ELYEMSLLKTQQMFNELNKTRKDDPEFILEQQKRKQEEKKKRLKKAFMFFRARTAHIEVVRDDQIELVFFPLLPFSKLNK
DEKQSFQQTVDRSSAKSKVQDLMEKSPELIQIMRHEEEMNRFYKQYKLIGFFANYIQLWKDLAFYLTLIINTMIIASFSH
QSDPDRPKEDVSSEALDEYVFFRKDEWTQAQTKELISALGYAMMVCSLFVVLFVLARIAPLIIKKALQRKPLLEGQGMIK
LLINWLAKFFFVLFYCLQDFQLVYYLGYGALSVIGTLVHPFFFCFHLTVILIRYPTLSNVVRAVTMPWQQLVLTLLLIII
ITYIFTLIAFYALQDPFGLDCKEVSICFLQIFDKNFKIPGGIGGDITNNNPSPTYEIFRYLYDQINNLLLVIIMVSIASG
IIIDTFGQLREDENKMNSDIKDKCFICGQENIIFERSSDGSSGGFKNHIRQNHYMWNYLYYIAYLQWKDPQDYSGIESYV
DKKIKDTDLSWIPFGRARELDKGEDESEKQAKQMEQSSSNIASLLTHSSDIIQALKEKKEKRKQHFTQQTQPTQYKEQIL
SQQSMALL