TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q45FP0|Q45FP0_HALAS Transmembrane protein OS=Halobacterium sp. (strain AS7092) GN=halU PE=4 SV=1
MARHGRTLVHGLRLGYVDVVRDWRTLERDRVRLALLAGAGLFGTLYFGVMALVVQGRTAELAARADPSLPPVVGLLVTLL
WLSSTAVFGQRAAVRTIDIDAPSLVLTSVRPRAVTIGVLSAEFLRGLAFVALPVGVLGVGFATGAGTSVPILTVPLATVL
FLTSSVCSGSAIGAVVAVWSRRARWKTGYVAGGLALLGALVVAGVMARLSTTPELAAGLPTSWYGDLFAVGTPIAASQAR
AFGAVLGTVAIGYAGGSVTERFATRLWLDEVESNRSARETAAAGERPRPFPRLRGRIDRPTRYVAWRSIQRVKRDPTRIS
HLGLPLLVGAWLLADLARSTAGRSLLPIAVGLLGSWFVGGFLTLNPLGDDGASLPATVTSPVDGSQFVRGTALPSGIVGV
PLLVAAGSAISIATSALPLALGLGLWVGVHGAAAIGIALAVGMRFPRFGAIRVSRRRTVVPPSLSAIVIYSTTVLSLGLV
GIGALIGPQLLLRDGAAATIAQGVSVLVWLSLEGGLGYGCYQVAVRRFDRYTLE