TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4UJ82|Q4UJ82_PARTE Chromosome undetermined scaffold_349, whole genome shotgun sequence OS=Paramecium tetraurelia GN=vhaA1 PE=3 SV=1
MNKQRKTQLEELQEKESSFGRVFKVAGPLVVAEKMAGAKMFELVKVGWDKLVGEIIKLEGDNASIQCYEDTSGLTVGDPV
MRTKSPLSVELGPGILTQIFDGIQRPLQVIAEQSSSIFVPRGVDIPALDQDRIWEFKPSSLVKVGSMISGGDIYGSVFEN
NLFDEHKILTAPRVQGRVTYIAPEGNYTLKDKVLEVELDGKKHQYGMSHFWPVRQPRPIIEKLQGNTPLLTGQRVLDALY
PSVLGGTCCIPGAFGCGKTCISQALSKYSNSECIIYVGCGERGNEMAEVLSEFPELTIQMKGKEENIMQRTCLVANTSNM
PVAAREASIYTGITLAEYFRDMGFNVSMMADSTSRWAEALREISGRLAEMPADQGYPAYLASKLAQFYERAGRVRCRGSP
DREGSITIVGAVSPPGGDFTDPVTTATLTIVQVFWGLDKKLAQRKHFPSVNWTISNSNYEKILEPYFNAFDPEFSHLRVM
FKQILHEESELNEIVQLVGRDSLSEDQKLSLEIAKIIREDFLQQDAFSKYDYNCPLYKTIGMMRCIVSFFECGKKAILES
SGDAKITWNIILNQTKPQFVKLSQMKFEDPKQPKQELMNYFTKFVDEIKSAFRNLTDK