TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q50862|RFBA_MYXXA O-antigen export system permease protein RfbA OS=Myxococcus xanthus GN=rfbA PE=3 SV=1
MIRLVRELYQYRGLLISLVQRELKARYRGSFLGFLWTFLNPTLHMLVYVLLFTVVMRQNIPNFPFFMFVGLLPWIWFSTS
VGGGASAISDRRDLLTKVRFPAQVLPTSVVVTNLCNFVLSLPLMLVLGMAYGQWPTWHVVLFPVVVLIQLTFTLALTYIL
AAINVTFRDLQHIVSNLLTLWFFATPVLYPLSTIQDESARSLMLALNPMVSLMTSYQAIFYEHRLPDAEPLMALAAVSVV
LLWAASSIFESRREEFAESI