TCDB is operated by the Saier Lab Bioinformatics Group
>Q5TLL2|Q5TLL2_STRMU SmbG protein - Streptococcus mutans.
MSQTECGLCVAVMLMEYYDVRITLNDIPKEFSAGRDGTRIRGLKKIFDHFGFSMNMFKVTDRLSEIKNSSLPGIAYRIGG
HFVVVESISSNEVIILDPAFGRTKISKDELDNDYKNLILKITPNENFKTVNTRGQEFSLIKEAVFFNKKLVVQVLIAAVI
VYSLTLVAPLLLKGLVDNFLVSKQIDTTIWALSIGTIASSLVYFVVNRVKQITSIRLSISVDKFLSKKVVDKLFKNKFEF
YLNRTSSDIQYRLVLLKNLKTIISDIIIQTFLDIGSMVVILIYIMNLQPLYAVFLAFITLLVLSMSRFMREKMLLYKNKE
LATDSKLQVFQYDIFRAIFDVKVLGLSSKKHRSWHRYYEDYIKSHEKNQRFITLYQNILAYITLYVPIFIPILGIWISGL
AHSNQVGTIISLQSITGTYISGLISIAQLSDNITTAKSYLIRIDDILLQEDEAVRNRTIDFKGNIRVNNLSFVYPGAEDK
TLDDISFSINEGESVAIVGESGSGKSTLFYILLGAYDNYEGDIYFEGLDLKILNKDALREQIGVVPQDALLFNGSIKENL
IEDFEVADNDIYDALKKVTLLDFVYSLPMGINTVVSENGFNFSGGQRQRLALARAILNQKSMLFLDEATSALDNITEHQI
VEYLSEDSKTKIVIAHRLSTIKNSDKIIVLKDGQVSEVGDHHSLMAQKGEYYRMYSGK