TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q63269|ITPR3_RAT Inositol 1,4,5-trisphosphate receptor type 3 OS=Rattus norvegicus GN=Itpr3 PE=1 SV=1
MNEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVCPMNRYSAQKQYWKAKQTKQD
KEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGS
WLFIQPFWKLRSNGDNVVVGDKVILNPVNAGQPLHASNYELSDNVGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYRGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEEN
PSYKGDVSDPKAAGPGAQSRTGRRNAGEKIKYRLVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQS
TNAPIDVEEERPIRLMLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMRDENILKQIFGILKAPFRDKGGEGPLVRLEELSDQKNAPYQYMFRLCYRVL
RHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVS
NRIAIPVTQELICKCVLDPKNSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDRNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISKQLGVELLFLCMADEMLPFDLRASFCHLMLHVHVDRDPQELVTPVKFA
RLWTEIPTAITIKDYDSNLNASRDDKKNKFASTMEFVEDYLNNVVGEAVPFANDEKNILTFEVVSLAHNLIYFGFYSFSE
LLRLTRTLLGIIDCIQAPAAVLQAYEEPGGKNVRRSIQGVGHMMSTMVLSRKQSVFGASSLPTGVGVPEQLDRSKFEDNE
HTVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSSTANMNLDRIGEQAEAMFGVGK
TSSMLEVDDEGGRMFLRVLLHLTMHDYPPLVSGALQLLFKHFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTM
VEKSELWVDKKGSVKGEEGEAGASKDKKERPSDEEGFLQPHGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKNDNKMMEILRYTHQFLQKFCAGNPGNQALLHKHLQLFLTPGLLEAETMQHIFLNNYQLCSEISE
PVLQHFVHCWPTHGRHVQYLDFLHTVIKAEGKYVKKCQDMIMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHS
PLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMALVCNKREKRLSDPTLEKYVLTVVLDTISAFFSSPFSENSTSLQTHQTIVVQLLQSTTRLLECPWLQQQHKG
SVEACVRTLAMVAKSRAILLPMDLDAHMSALLSSGGSCSAAAQRSAANYKTATRTFPRVIPTANQWDYKNIIEKLQDIIT
ALEERLKPLVQAELSVLVDMLHWPELLFLEGSEAYQRCESGGFLSKLIRHTKGLMESEEKLCVKVLRTLQQMLQKKSKYG
DRGNQLRKMLLQNYLQNRKSGPRGELTDPTGSGVDQDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIFQESIGLAIRL
LDGGNTEIQKSFYNLMTSDKKSERFFKVLHDRMKRAQQETKSTVAVNMSDLGSQPREDREPADPTTKGRVSSFSMPSSSR
YSLGPGLHRGHDVSERAQNNEMGTSVLIMRPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGG
LGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISPLCKYRMDLVLQLKDNASKLLL
ALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERENSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEE
AEGISSMLSLNNKQLSQMLKSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPAICQFLTEETKHRLFTTTEQ
DEQGSKVSDFFDQSSFLHNEMEWQRRLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIAFFYPYVEGASTGVLGSPLISL
LFWILICFSIAALFTKHYSVRPLIVALVLRSIYYLGIGPTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFL
YHVGYILTSVLGLFAHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDR
LPGNHSRASTLGMPHGAATFMGTCSGDKMDCVSEVSVPEILEEDEELDSTERACDTLLMCIVTVMNHGLRNGGGVGDILR
KPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKL
EHNMWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSGEGEGEQNEIRILQEKLGSTMKLVSHLTA
QLNELKEQMTEQRKRRQRLGFVDVQNCMSR