TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6BFK1|Q6BFK1_PARTE Chromosome undetermined scaffold_1, whole genome shotgun sequence OS=Paramecium tetraurelia GN=VATA1 PE=4 SV=1
MIRSEGMSLYQLLIPRESSYDVMSELGQIDSVMIIDHQQHLLSKPFINQVQRCDEILNKVEYLLDQLNQIGQTIDHVYDF
KLMLQEFDRVLSLKQIQKHTFINQIEEYITGKYQQVQQQIDTLSRLKSKLQNTREAKQAMIYARDWLGGAYFHSKSSTAL
DFDEQMIKSYHQHGGMMPSQKFTHFVGVMNSKDYQIFQRTVFRITKGNFMVNQTLLSVSRSCFLLIFPTFSLQSETWRKI
KKLCDVLKVDHISLPLTEEQWDQRYCDYDKDIAEIENMNKLTHQLLQSILKPLLEDENTQPSLLFIRFFLVRERTLYENL
NKVKMQQSIFLANLWVRTSEIQLLENILQTIKQKNPHIPAPQIKINEIVNQQPPTYFQTNQFNKLFQLITETYGIPDYKE
INPSMFSIITFPFLFGVMFGDIGHGAAILIFGILLSMNKVFSPRSEQKKLREQRIQLGLQIKRQVNSKDFNDEDLNDFNL
TQIIFDLRYMLLLCGAFSLYTGFIYNEYFGLSLNIFGSCMNIQDCTYPFGLDPQYEDLSFRNSYKMKLAIIIGFSQMLLG
ILCSGFNYLYFKKWINLFILFPARLLFFTLFIGYMVMLIIIKWSTFYADTSQAPSIITTLVDMWMHDGQVTLKTFESADY
QSQLQKLILVICILCLPFLLFAPIIADSIAMIKQKKKESARFEMIPQNINSNLSNDDFVSKQSQHQSYIDIIVEHLIETL
EFVLGCISNTASYLRLWALSLAHSELAKVLFDLTLKEPIANADLLASLLGMPAFLLSTFGILLCMDSMECFLHALRLHWV
EFQSKFYKGNGYNFEIFSYRKEMKKYQDKMKT